PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628634.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 281aa    MW: 31786.7 Da    PI: 4.9836
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628634.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
   XP_009628634.1 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.5e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
   XP_009628634.1  71 SDAEEKLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466892.43E-2611108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002498.9E-151461IPR001005SANT/Myb domain
CDDcd001679.45E-91661No hitNo description
PROSITE profilePS5129426.19562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2463116IPR009057Homeodomain-like
SMARTSM007172.1E-1466114IPR001005SANT/Myb domain
PfamPF002491.9E-1471111IPR001005SANT/Myb domain
CDDcd001671.22E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLK KEANLIDQPI PESDQNKNNG HQQVQVVPEC TSVTAAATSS ELDNSSSSTS  180
SSENSSSITD ESKLVLNTLC ENDPLLRSLL EADAPLVDSL WELPVSSEEQ KNFDNMTSWD  240
DSFNWLLDCQ DFGIHDFGFD NCFNDVELEV FNTIDDMENK Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7059770.0AY705977.1 Petunia x hybrida MYB-like protein ODORANT1 mRNA, complete cds.
GenBankJF7939140.0JF793914.1 Petunia axillaris isolate S7 MYB transcription factor ODO1 (ODO1) mRNA, complete cds.
GenBankJF7939160.0JF793916.1 Petunia exserta MYB transcription factor ODO1 (ODO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628634.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-162ODO1_PETHY; Protein ODORANT1
TrEMBLF5CSR81e-160F5CSR8_9SOLA; MYB transcription factor ODO1
STRINGSolyc08g079270.2.11e-153(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.18e-92myb domain protein 85